PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H00560.1.p
Common NameEUGRSUZ_H00560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 330aa    MW: 36573.7 Da    PI: 8.2872
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H00560.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.65.8e-28281330251
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                       pr+rWt+ LH+rFv+av  LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Eucgr.H00560.1.p 281 PRMRWTSSLHARFVHAVGLLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 330
                       9************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-12278330IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-24279330IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-20281330IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEEESSFPDL SLHISPPNSA PSSICGGGNN EGDSNSSFDI WRRGAEDDDD YHYALRSHSD  60
SSVLKADAAA DTRLSLSNLP AAAVAASNPL EAESPWRRSM MDTHNGDHQV EDYFKRRHAI  120
GNGSLGHISS GMSLLGVSDK LRPIKGIPVY NTGACNNSFQ FPLQADRDFP RDVMTTRDSN  180
PKLSYNFPRP SNIMMSMNNS SSSPSNYFEP MYVLNSGGGG GSRFNGITMD NLNHNFKSRQ  240
MMMQYLHQHH QYGSSGESNG LVSRFRFVPK LQSNKRNMRA PRMRWTSSLH ARFVHAVGLL  300
GGHERATPKS VLELMDVKDL TLAHVKSHLQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H00560.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069447.10.0PREDICTED: probable transcription factor KAN4 isoform X2
RefseqXP_010069448.10.0PREDICTED: probable transcription factor KAN4 isoform X3
TrEMBLA0A059AVB00.0A0A059AVB0_EUCGR; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17814510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-32G2-like family protein